PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34454.9 Da    PI: 4.4727
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-4156383PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1992145356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t +q++ Le+ Fe ++++  +++ +LAk+lgL+ rqV +WFqNrRa++k
  Lsa008467  92 KKRRLTVDQVRFLEKSFELDNKLEPDRKIQLAKELGLQPRQVAIWFQNRRARWK 145
                56689************************************************9 PP

2HD-ZIP_I/II127.36.7e-4191182192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ +qv++LE+sFe ++kLep+rK +la+eLglqprqva+WFqnrRAR+ktkqlEkdy+ L+++y++lk++ e+L ke+e+L++++ 
    Lsa008467  91 EKKRRLTVDQVRFLEKSFELDNKLEPDRKIQLAKELGLQPRQVAIWFQNRRARWKTKQLEKDYDDLQESYNKLKANYENLLKEKEKLKSKVG 182
                  69**************************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-2071149IPR009057Homeodomain-like
PROSITE profilePS5007117.60587147IPR001356Homeobox domain
SMARTSM003892.4E-2090151IPR001356Homeobox domain
CDDcd000861.57E-1992148No hitNo description
PfamPF000461.1E-1692145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-2094154IPR009057Homeodomain-like
PRINTSPR000316.6E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.6E-6127143IPR000047Helix-turn-helix motif
PfamPF021835.8E-13147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAARSYLYGG ASGGEAESGG SVLLTNKRVH CSSSLNPVDS FFASRSSPFQ GSRSMVSFED  60
RGNGSGGQFF QSFDHEDNGD DEYDEYFQQP EKKRRLTVDQ VRFLEKSFEL DNKLEPDRKI  120
QLAKELGLQP RQVAIWFQNR RARWKTKQLE KDYDDLQESY NKLKANYENL LKEKEKLKSK  180
VGELSDKLMI QEKGTSDASS TKSPCEPQLC ELVLEEDLSK NLNLTCGPEG DLNVVFERGD  240
SSYVFEQEQS DGSLDEENDN FGKMFLPSMD GYTSPKIENV DPHAVNSYYL GLAGDDQAFG  300
FWSY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321530.29e-99hypothetical protein POPTR_0015s07640g
TrEMBLA0A124SE251e-147A0A124SE25_CYNCS; Helix-turn-helix motif-containing protein
STRINGPOPTR_0015s07640.13e-98(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-35homeobox 1